SCOPe 2.05: Domain d2g7yb_: 2g7y B:

Lineage for d2g7yb_ (2g7y B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein (Pro)cathepsin S [82566] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82567] (23 PDB entries)

8. Domain d2g7yb_: 2g7y B: [134740]
   automated match to d1ms6a_
   complexed with mo9

Details for d2g7yb_

PDB Entry: 2g7y, 2 Å

PDB Description: human cathepsin s with inhibitor cra-16981

PDB Compounds: (B:) cathepsin S

SCOPe Domain Sequences for d2g7yb_:

Sequence; same for both SEQRES and ATOM records:

>d2g7yb_ d.3.1.1 (B:) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]}
ilpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcste
kygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpyg
redvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkey
wlvknswghnfgeegyirmarnkgnhcgiasfpsypei

Timeline for d2g7yb_:

• d2g7yb_ first appeared in SCOP 1.73, called d2g7yb1
  
• d2g7yb_ appears in SCOPe 2.04
  
• d2g7yb_ appears in SCOPe 2.06
  
• d2g7yb_ appears in the current release, SCOPe 2.08