Lineage for d2g7la2 (2g7l A:87-230)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 647677Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 647678Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) (S)
  5. 647679Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (28 proteins)
  6. 647790Protein Putative transcriptional regulator SCO7704 [140885] (1 species)
  7. 647791Species Streptomyces coelicolor [TaxId:1902] [140886] (1 PDB entry)
  8. 647792Domain d2g7la2: 2g7l A:87-230 [134735]
    Other proteins in same PDB: d2g7la1

Details for d2g7la2

PDB Entry: 2g7l (more details), 2.1 Å

PDB Description: crystal structure of putative transcription regulator sco7704 from streptomyces coelicor
PDB Compounds: (A:) TetR-family transcriptional regulator

SCOP Domain Sequences for d2g7la2:

Sequence, based on SEQRES records: (download)

>d2g7la2 a.121.1.1 (A:87-230) Putative transcriptional regulator SCO7704 {Streptomyces coelicolor [TaxId: 1902]}
edwreqlravltsytlvlfahpqlarsalvarpsgenylrlvervlellarsgapgaqva
wgvdkllqdatataaeqatqehdpashedwsatvralrdadeathpaiashmpllvagsa
hdrlrwsfdvlvngitrtpvpgpa

Sequence, based on observed residues (ATOM records): (download)

>d2g7la2 a.121.1.1 (A:87-230) Putative transcriptional regulator SCO7704 {Streptomyces coelicolor [TaxId: 1902]}
edwreqlravltsytlvlfahpqlarsalvarpsgenylrlvervlellarsgapgaqva
wgvdkllqdatataaeqatsatvralrdadeathpaiashmpllvagsahdrlrwsfdvl
vngitrtpvpgpa

SCOP Domain Coordinates for d2g7la2:

Click to download the PDB-style file with coordinates for d2g7la2.
(The format of our PDB-style files is described here.)

Timeline for d2g7la2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2g7la1