Lineage for d2g7la2 (2g7l A:87-230)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
multihelical; interlocked (homo)dimerSuperfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) 
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) 
Protein Putative transcriptional regulator SCO7704 [140885] (1 species) Species Streptomyces coelicolor [TaxId:1902] [140886] (1 PDB entry)
Uniprot Q93JG8 87-230
Domain d2g7la2: 2g7l A:87-230 [134735]
Other proteins in same PDB: d2g7la1
Details for d2g7la2
PDB Entry: 2g7l (more details), 2.1 Å
PDB Description: crystal structure of putative transcription regulator sco7704 from streptomyces coelicor
PDB Compounds: (A:) TetR-family transcriptional regulatorSCOPe Domain Sequences for d2g7la2:
Sequence, based on SEQRES records: (download)
>d2g7la2 a.121.1.1 (A:87-230) Putative transcriptional regulator SCO7704 {Streptomyces coelicolor [TaxId: 1902]}
edwreqlravltsytlvlfahpqlarsalvarpsgenylrlvervlellarsgapgaqva
wgvdkllqdatataaeqatqehdpashedwsatvralrdadeathpaiashmpllvagsa
hdrlrwsfdvlvngitrtpvpgpa
Sequence, based on observed residues (ATOM records): (download)
>d2g7la2 a.121.1.1 (A:87-230) Putative transcriptional regulator SCO7704 {Streptomyces coelicolor [TaxId: 1902]}
edwreqlravltsytlvlfahpqlarsalvarpsgenylrlvervlellarsgapgaqva
wgvdkllqdatataaeqatsatvralrdadeathpaiashmpllvagsahdrlrwsfdvl
vngitrtpvpgpa
SCOPe Domain Coordinates for d2g7la2:
Click to download the PDB-style file with coordinates for d2g7la2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2g7la2:
- d2g7la2 first appeared in SCOP 1.73
- d2g7la2 appears in SCOPe 2.07
View in 3D
