Lineage for d2g7la1 (2g7l A:16-83)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692210Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 2692437Protein Putative transcriptional regulator SCO7704 [140199] (1 species)
  7. 2692438Species Streptomyces coelicolor [TaxId:1902] [140200] (1 PDB entry)
    Uniprot Q93JG8 16-83
  8. 2692439Domain d2g7la1: 2g7l A:16-83 [134734]
    Other proteins in same PDB: d2g7la2

Details for d2g7la1

PDB Entry: 2g7l (more details), 2.1 Å

PDB Description: crystal structure of putative transcription regulator sco7704 from streptomyces coelicor
PDB Compounds: (A:) TetR-family transcriptional regulator

SCOPe Domain Sequences for d2g7la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g7la1 a.4.1.9 (A:16-83) Putative transcriptional regulator SCO7704 {Streptomyces coelicolor [TaxId: 1902]}
kpalsrrwivdtavalmraeglekvtmrrlaqeldtgpaslyvyvantaelhaavldall
gevdltga

SCOPe Domain Coordinates for d2g7la1:

Click to download the PDB-style file with coordinates for d2g7la1.
(The format of our PDB-style files is described here.)

Timeline for d2g7la1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2g7la2