SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2g7la1 (2g7l A:16-83)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1981148Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1981577Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 protein domains)
  6. 1981765Protein Putative transcriptional regulator SCO7704 [140199] (1 species)
  7. 1981766Species Streptomyces coelicolor [TaxId:1902] [140200] (1 PDB entry)
    Uniprot Q93JG8 16-83
  8. 1981767Domain d2g7la1: 2g7l A:16-83 [134734]
    Other proteins in same PDB: d2g7la2

Details for d2g7la1

PDB Entry: 2g7l (more details), 2.1 Å

PDB Description: Crystal structure of putative transcription regulator SCO7704 from Streptomyces coelicor
PDB Compounds: (A:) TetR-family transcriptional regulator

SCOPe Domain Sequences for d2g7la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g7la1 a.4.1.9 (A:16-83) Putative transcriptional regulator SCO7704 {Streptomyces coelicolor [TaxId: 1902]}
kpalsrrwivdtavalmraeglekvtmrrlaqeldtgpaslyvyvantaelhaavldall
gevdltga

SCOPe Domain Coordinates for d2g7la1:

Click to download the PDB-style file with coordinates for d2g7la1.
(The format of our PDB-style files is described here.)

Timeline for d2g7la1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2g7la2