Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) consists only of helices |
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
Protein Putative transcriptional regulator SCO7704 [140199] (1 species) |
Species Streptomyces coelicolor [TaxId:1902] [140200] (1 PDB entry) Uniprot Q93JG8 16-83 |
Domain d2g7la1: 2g7l A:16-83 [134734] Other proteins in same PDB: d2g7la2 |
PDB Entry: 2g7l (more details), 2.1 Å
SCOPe Domain Sequences for d2g7la1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g7la1 a.4.1.9 (A:16-83) Putative transcriptional regulator SCO7704 {Streptomyces coelicolor [TaxId: 1902]} kpalsrrwivdtavalmraeglekvtmrrlaqeldtgpaslyvyvantaelhaavldall gevdltga
Timeline for d2g7la1: