Lineage for d2g7ga2 (2g7g A:74-205)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
multihelical; interlocked (homo)dimerSuperfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) 
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) 
Protein Putative transcriptional regulator Rha04620 [140903] (1 species) Species Rhodococcus sp. RHA1 [TaxId:101510] [140904] (1 PDB entry) 
Domain d2g7ga2: 2g7g A:74-205 [134733]
Other proteins in same PDB: d2g7ga1
complexed with acy
Details for d2g7ga2
PDB Entry: 2g7g (more details), 2.01 Å
PDB Description: The Crystal Structure of the Putative Transcriptional Regulator Rha04620 from Rhodococcus sp. RHA1
PDB Compounds: (A:) Rha04620, Putative Transcriptional RegulatorSCOPe Domain Sequences for d2g7ga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g7ga2 a.121.1.1 (A:74-205) Putative transcriptional regulator Rha04620 {Rhodococcus sp. RHA1 [TaxId: 101510]}
lpwdeafsewarsyraafsrhptairllatetvrdpgslsvyhsaaaglrgagfpddhim
avitaaenfllgaaldaaapevmieadstttddaltralaaaprgperaeqafelglaal
lagfhhllqecg
SCOPe Domain Coordinates for d2g7ga2:
Click to download the PDB-style file with coordinates for d2g7ga2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2g7ga2:
- d2g7ga2 first appeared in SCOP 1.73
- d2g7ga2 appears in SCOPe 2.06
- d2g7ga2 appears in the current release, SCOPe 2.08
View in 3D
