Lineage for d2g77a2 (2g77 A:443-633)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000218Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2000518Superfamily a.69.2: Ypt/Rab-GAP domain of gyp1p [47923] (1 family) (S)
  5. 2000519Family a.69.2.1: Ypt/Rab-GAP domain of gyp1p [47924] (1 protein)
    duplication: contains two similar domains of this fold
  6. 2000520Protein Ypt/Rab-GAP domain of gyp1p [47925] (1 species)
  7. 2000521Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47926] (2 PDB entries)
  8. 2000525Domain d2g77a2: 2g77 A:443-633 [134731]
    Other proteins in same PDB: d2g77b1
    complexed with af3, gdp, mg

Details for d2g77a2

PDB Entry: 2g77 (more details), 2.26 Å

PDB Description: Crystal Structure of Gyp1 TBC domain in complex with Rab33 GTPase bound to GDP and AlF3
PDB Compounds: (A:) GTPase-activating protein GYP1

SCOPe Domain Sequences for d2g77a2:

Sequence, based on SEQRES records: (download)

>d2g77a2 a.69.2.1 (A:443-633) Ypt/Rab-GAP domain of gyp1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gqpgilrqvknlsqlvkridadlynhfqnehvefiqfafrwmncllmrefqmgtvirmwd
tylsetsqevtssysmssndikppvtpteprvasfvtptkdfqspttalsnmtpnnaved
sgkmrqsslnefhvfvcaaflikwsdqlmemdfqetitflqnpptkdwtetdiemllsea
fiwqslykdat

Sequence, based on observed residues (ATOM records): (download)

>d2g77a2 a.69.2.1 (A:443-633) Ypt/Rab-GAP domain of gyp1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gqpgilrqvknlsqlvkridadlynhfqnehvefiqfafrwmncllmrefqmgtvirmwd
tylsetsqqsslnefhvfvcaaflikwsdqlmemdfqetitflqnpptkdwtetdiemll
seafiwqslykdat

SCOPe Domain Coordinates for d2g77a2:

Click to download the PDB-style file with coordinates for d2g77a2.
(The format of our PDB-style files is described here.)

Timeline for d2g77a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2g77a1
View in 3D
Domains from other chains:
(mouse over for more information)
d2g77b1