Class a: All alpha proteins [46456] (284 folds) |
Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.2: Ypt/Rab-GAP domain of gyp1p [47923] (1 family) |
Family a.69.2.1: Ypt/Rab-GAP domain of gyp1p [47924] (1 protein) duplication: contains two similar domains of this fold |
Protein Ypt/Rab-GAP domain of gyp1p [47925] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47926] (2 PDB entries) |
Domain d2g77a1: 2g77 A:249-442 [134730] Other proteins in same PDB: d2g77b1 automatically matched to d1fkma1 complexed with af3, gdp, mg; mutant |
PDB Entry: 2g77 (more details), 2.26 Å
SCOP Domain Sequences for d2g77a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g77a1 a.69.2.1 (A:249-442) Ypt/Rab-GAP domain of gyp1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} nsiiqriskfdnilkdktiinqqdlrqiswngipkihrpvvwklligylpvntkrqegfl qrkrkeyrdslkhtfsdqhsrdiptwhqieidiprtnphiplyqfksvqnslqrilylwa irhpasgyvqgindlvtpffetflteylppsqiddvkikdpstymvdeqitdleadtfwc ltklleqitdnyih
Timeline for d2g77a1: