SCOP 1.73: Domain d2g77a1: 2g77 A:249-442

Lineage for d2g77a1 (2g77 A:249-442)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.69: Left-handed superhelix [47916] (3 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.2: Ypt/Rab-GAP domain of gyp1p [47923] (1 family)

5. Family a.69.2.1: Ypt/Rab-GAP domain of gyp1p [47924] (1 protein)
   duplication: contains two similar domains of this fold

6. Protein Ypt/Rab-GAP domain of gyp1p [47925] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47926] (2 PDB entries)

8. Domain d2g77a1: 2g77 A:249-442 [134730]
   automatically matched to d1fkma1
   complexed with af3, gdp, mg; mutant

Details for d2g77a1

PDB Entry: 2g77, 2.26 Å

PDB Description: crystal structure of gyp1 tbc domain in complex with rab33 gtpase bound to gdp and alf3

PDB Compounds: (A:) GTPase-activating protein GYP1

SCOP Domain Sequences for d2g77a1:

Sequence; same for both SEQRES and ATOM records:

>d2g77a1 a.69.2.1 (A:249-442) Ypt/Rab-GAP domain of gyp1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nsiiqriskfdnilkdktiinqqdlrqiswngipkihrpvvwklligylpvntkrqegfl
qrkrkeyrdslkhtfsdqhsrdiptwhqieidiprtnphiplyqfksvqnslqrilylwa
irhpasgyvqgindlvtpffetflteylppsqiddvkikdpstymvdeqitdleadtfwc
ltklleqitdnyih

Timeline for d2g77a1:

• d2g77a1 is new in SCOP 1.73
  
• d2g77a1 appears in SCOP 1.75
  
• d2g77a1 appears in the current release, SCOPe 2.08