SCOPe 2.07: Domain d2g74b2: 2g74 B:4-182

Lineage for d2g74b2 (2g74 B:4-182)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.2: IPP isomerase-like [64369] (4 proteins)

6. Protein automated matches [190207] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [186960] (3 PDB entries)

8. Domain d2g74b2: 2g74 B:4-182 [134729]
   Other proteins in same PDB: d2g74b3
   automated match to d1nfsb_
   complexed with mg, mn; mutant

Details for d2g74b2

PDB Entry: 2g74, 1.96 Å

PDB Description: y104f mutant of type 1 isopentenylpyrophosphate- dimethylallylpyrophosphate isomerase

PDB Compounds: (B:) Isopentenyl-diphosphate delta-isomerase

SCOPe Domain Sequences for d2g74b2:

Sequence; same for both SEQRES and ATOM records:

>d2g74b2 d.113.1.2 (B:4-182) automated matches {Escherichia coli [TaxId: 562]}
ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt
nsvcghpqlgesnedavirrcryelgveitppesiypdfrfratdpsgivenevcpvfaa
rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftqlk

Timeline for d2g74b2:

• d2g74b2 first appeared in SCOP 1.73, called d2g74b1
  
• d2g74b2 appears in SCOPe 2.06
  
• d2g74b2 appears in the current release, SCOPe 2.08