Lineage for d2g74b2 (2g74 B:4-182)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2535539Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2535540Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2535778Family d.113.1.2: IPP isomerase-like [64369] (4 proteins)
  6. 2535824Protein automated matches [190207] (2 species)
    not a true protein
  7. 2535828Species Escherichia coli [TaxId:562] [186960] (3 PDB entries)
  8. 2535832Domain d2g74b2: 2g74 B:4-182 [134729]
    Other proteins in same PDB: d2g74b3
    automated match to d1nfsb_
    complexed with mg, mn; mutant

Details for d2g74b2

PDB Entry: 2g74 (more details), 1.96 Å

PDB Description: y104f mutant of type 1 isopentenylpyrophosphate- dimethylallylpyrophosphate isomerase
PDB Compounds: (B:) Isopentenyl-diphosphate delta-isomerase

SCOPe Domain Sequences for d2g74b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g74b2 d.113.1.2 (B:4-182) automated matches {Escherichia coli [TaxId: 562]}
ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt
nsvcghpqlgesnedavirrcryelgveitppesiypdfrfratdpsgivenevcpvfaa
rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftqlk

SCOPe Domain Coordinates for d2g74b2:

Click to download the PDB-style file with coordinates for d2g74b2.
(The format of our PDB-style files is described here.)

Timeline for d2g74b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2g74b3
View in 3D
Domains from other chains:
(mouse over for more information)
d2g74a_