![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
![]() | Superfamily d.113.1: Nudix [55811] (8 families) ![]() |
![]() | Family d.113.1.2: IPP isomerase-like [64369] (4 proteins) |
![]() | Protein automated matches [190207] (2 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [186960] (3 PDB entries) |
![]() | Domain d2g74a_: 2g74 A: [134728] Other proteins in same PDB: d2g74b3 automated match to d1nfsb_ complexed with mg, mn; mutant |
PDB Entry: 2g74 (more details), 1.96 Å
SCOPe Domain Sequences for d2g74a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g74a_ d.113.1.2 (A:) automated matches {Escherichia coli [TaxId: 562]} ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt nsvcghpqlgesnedavirrcryelgveitppesiypdfrfratdpsgivenevcpvfaa rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaft
Timeline for d2g74a_: