Lineage for d2g74a1 (2g74 A:4-179)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 731929Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 731930Superfamily d.113.1: Nudix [55811] (7 families) (S)
  5. 732058Family d.113.1.2: IPP isomerase-like [64369] (3 proteins)
  6. 732067Protein Isopentenyl diphosphate isomerase [64370] (1 species)
  7. 732068Species Escherichia coli [TaxId:562] [64371] (16 PDB entries)
  8. 732083Domain d2g74a1: 2g74 A:4-179 [134728]
    automatically matched to 1X83 A:4-179
    complexed with mg, mn; mutant

Details for d2g74a1

PDB Entry: 2g74 (more details), 1.96 Å

PDB Description: y104f mutant of type 1 isopentenylpyrophosphate- dimethylallylpyrophosphate isomerase
PDB Compounds: (A:) Isopentenyl-diphosphate delta-isomerase

SCOP Domain Sequences for d2g74a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g74a1 d.113.1.2 (A:4-179) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]}
ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt
nsvcghpqlgesnedavirrcryelgveitppesiypdfrfratdpsgivenevcpvfaa
rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaft

SCOP Domain Coordinates for d2g74a1:

Click to download the PDB-style file with coordinates for d2g74a1.
(The format of our PDB-style files is described here.)

Timeline for d2g74a1: