![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
![]() | Superfamily d.113.1: Nudix [55811] (8 families) ![]() |
![]() | Family d.113.1.2: IPP isomerase-like [64369] (4 proteins) |
![]() | Protein automated matches [190207] (2 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [186960] (3 PDB entries) |
![]() | Domain d2g73b2: 2g73 B:4-182 [134727] Other proteins in same PDB: d2g73b3 automated match to d1nfsb_ complexed with eip, mg, mn; mutant |
PDB Entry: 2g73 (more details), 1.97 Å
SCOPe Domain Sequences for d2g73b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g73b2 d.113.1.2 (B:4-182) automated matches {Escherichia coli [TaxId: 562]} ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt nsvcghpqlgesnedavirrcryelgveitppesiypdfrfratdpsgivenevcpvfaa rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftqlk
Timeline for d2g73b2: