SCOPe 2.05: Domain d2g73a_: 2g73 A:

Lineage for d2g73a_ (2g73 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.2: IPP isomerase-like [64369] (4 proteins)

6. Protein automated matches [190207] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [186960] (3 PDB entries)

8. Domain d2g73a_: 2g73 A: [134726]
   automated match to d1nfsb_
   complexed with eip, mg, mn; mutant

Details for d2g73a_

PDB Entry: 2g73, 1.97 Å

PDB Description: y104f mutant type 1 ipp isomerase complex with eipp

PDB Compounds: (A:) Isopentenyl-diphosphate delta-isomerase

SCOPe Domain Sequences for d2g73a_:

Sequence; same for both SEQRES and ATOM records:

>d2g73a_ d.113.1.2 (A:) automated matches {Escherichia coli [TaxId: 562]}
ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt
nsvcghpqlgesnedavirrcryelgveitppesiypdfrfratdpsgivenevcpvfaa
rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaft

Timeline for d2g73a_:

• d2g73a_ first appeared in SCOP 1.73, called d2g73a1
  
• d2g73a_ appears in SCOPe 2.04
  
• d2g73a_ appears in SCOPe 2.06
  
• d2g73a_ appears in the current release, SCOPe 2.08