SCOP 1.75: Domain d2g73a1: 2g73 A:4-179

Lineage for d2g73a1 (2g73 A:4-179)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (7 families)

5. Family d.113.1.2: IPP isomerase-like [64369] (3 proteins)

6. Protein Isopentenyl diphosphate isomerase [64370] (1 species)

7. Species Escherichia coli [TaxId:562] [64371] (18 PDB entries)
   Uniprot Q46822

8. Domain d2g73a1: 2g73 A:4-179 [134726]
   automatically matched to 1X83 A:4-179
   complexed with eip, mg, mn; mutant

Details for d2g73a1

PDB Entry: 2g73, 1.97 Å

PDB Description: y104f mutant type 1 ipp isomerase complex with eipp

PDB Compounds: (A:) Isopentenyl-diphosphate delta-isomerase

SCOP Domain Sequences for d2g73a1:

Sequence; same for both SEQRES and ATOM records:

>d2g73a1 d.113.1.2 (A:4-179) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]}
ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt
nsvcghpqlgesnedavirrcryelgveitppesiypdfrfratdpsgivenevcpvfaa
rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaft

Timeline for d2g73a1:

• d2g73a1 first appeared in SCOP 1.73
  
• d2g73a1 is called d2g73a_ in SCOPe 2.01
  
• d2g73a1 appears in the current release, SCOPe 2.08, called d2g73a_