![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) ![]() |
![]() | Family c.66.1.15: Arylamine N-methyltransferase [69547] (3 proteins) automatically mapped to Pfam PF01234 |
![]() | Protein Phenylethanolamine N-methyltransferase, PNMTase [69548] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [69549] (8 PDB entries) |
![]() | Domain d2g71a2: 2g71 A:21-280 [134722] Other proteins in same PDB: d2g71a3, d2g71b3 automated match to d1hnnb_ complexed with fts, gol, sah |
PDB Entry: 2g71 (more details), 2.2 Å
SCOPe Domain Sequences for d2g71a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g71a2 c.66.1.15 (A:21-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} aavasayqrfepraylrnnyapprgdlcnpngvgpwklrclaqtfatgevsgrtlidigs gptvyqllsacshfeditmtdflevnrqelgrwlqeepgafnwsmysqhacliegkgecw qdkerqlrarvkrvlpidvhqpqplgagspaplpadalvsafcleavspdlasfqraldh ittllrpgghllligaleeswylagearltvvpvseeevrealvrsgykvrdlrtyimpa hlqtgvddvkgvffawaqkv
Timeline for d2g71a2: