SCOPe 2.05: Domain d2g70b_: 2g70 B:

Lineage for d2g70b_ (2g70 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.15: Arylamine N-methyltransferase [69547] (3 proteins)
   automatically mapped to Pfam PF01234

6. Protein automated matches [190168] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186895] (33 PDB entries)

8. Domain d2g70b_: 2g70 B: [134721]
   automated match to d1hnnb_
   complexed with hnt, po4, sam

Details for d2g70b_

PDB Entry: 2g70, 2.4 Å

PDB Description: Structure of human PNMT in complex with inhibitor 3-hydroxymethyl-7-nitro-THIQ and AdoMet (SAM)

PDB Compounds: (B:) Phenylethanolamine N-methyltransferase

SCOPe Domain Sequences for d2g70b_:

Sequence; same for both SEQRES and ATOM records:

>d2g70b_ c.66.1.15 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sapgqaavasayqrfepraylrnnyapprgdlcnpngvgpwklrclaqtfatgevsgrtl
idigsgptvyqllsacshfeditmtdflevnrqelgrwlqeepgafnwsmysqhaclieg
kgecwqdkerqlrarvkrvlpidvhqpqplgagspaplpadalvsafcleavspdlasfq
raldhittllrpgghllligaleeswylagearltvvpvseeevrealvrsgykvrdlrt
yimpahlqtgvddvkgvffawaqkv

Timeline for d2g70b_:

• d2g70b_ first appeared in SCOP 1.73, called d2g70b1
  
• d2g70b_ appears in SCOPe 2.04
  
• d2g70b_ appears in SCOPe 2.06
  
• d2g70b_ appears in the current release, SCOPe 2.08