SCOP 1.73: Domain d2g70b1: 2g70 B:18-280

Lineage for d2g70b1 (2g70 B:18-280)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families)

5. Family c.66.1.15: Arylamine N-methyltransferase [69547] (2 proteins)

6. Protein Phenylethanolamine N-methyltransferase, PNMTase [69548] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69549] (11 PDB entries)

8. Domain d2g70b1: 2g70 B:18-280 [134721]
   automatically matched to d1hnnb_
   complexed with hnt, po4, sam

Details for d2g70b1

PDB Entry: 2g70, 2.4 Å

PDB Description: Structure of human PNMT in complex with inhibitor 3-hydroxymethyl-7-nitro-THIQ and AdoMet (SAM)

PDB Compounds: (B:) Phenylethanolamine N-methyltransferase

SCOP Domain Sequences for d2g70b1:

Sequence; same for both SEQRES and ATOM records:

>d2g70b1 c.66.1.15 (B:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]}
pgqaavasayqrfepraylrnnyapprgdlcnpngvgpwklrclaqtfatgevsgrtlid
igsgptvyqllsacshfeditmtdflevnrqelgrwlqeepgafnwsmysqhacliegkg
ecwqdkerqlrarvkrvlpidvhqpqplgagspaplpadalvsafcleavspdlasfqra
ldhittllrpgghllligaleeswylagearltvvpvseeevrealvrsgykvrdlrtyi
mpahlqtgvddvkgvffawaqkv

Timeline for d2g70b1:

• d2g70b1 is new in SCOP 1.73
  
• d2g70b1 appears in SCOP 1.75
  
• d2g70b1 appears in the current release, SCOPe 2.08, called d2g70b_