SCOPe 2.05: Domain d2g6wa_: 2g6w A:

Lineage for d2g6wa_ (2g6w A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
   formerly omega-Aminoacid:pyruvate aminotransferase-like

6. Protein automated matches [190152] (18 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187107] (1 PDB entry)

8. Domain d2g6wa_: 2g6w A: [134719]
   automated match to d1bs0a_
   complexed with llf

Details for d2g6wa_

PDB Entry: 2g6w, 2.14 Å

PDB Description: suicide inhibition of a-oxamine synthase: structures of the covalent adducts of 8-amino-7-oxonanoate synthase with trifluoroalanine

PDB Compounds: (A:) 8-amino-7-oxononanoate synthase

SCOPe Domain Sequences for d2g6wa_:

Sequence; same for both SEQRES and ATOM records:

>d2g6wa_ c.67.1.4 (A:) automated matches {Escherichia coli [TaxId: 562]}
swqekinaaldarraadalrrrypvaqgagrwlvaddrqylnfssndylglshhpqiira
wqqgaeqfgigsggsghvsgysvvhqaleeelaewlgysrallfisgfaanqaviaamma
kedriaadrlshaslleaaslspsqlrrfahndvthlarllaspcpgqqmvvtegvfsmd
gdsaplaeiqqvtqqhngwlmvddahgtgvigeqgrgscwlqkvkpellvvtfgkgfgvs
gaavlcsstvadyllqfarhliystsmppaqaqalraslavirsdegdarreklaalitr
fragvqdlpftladscsaiqplivgdnsralqlaeklrqqgcwvtairpptvpagtarlr
ltltaahemqdidrllevlhgng

Timeline for d2g6wa_:

• d2g6wa_ first appeared in SCOP 1.73, called d2g6wa1
  
• d2g6wa_ appears in SCOPe 2.04
  
• d2g6wa_ appears in SCOPe 2.06
  
• d2g6wa_ appears in the current release, SCOPe 2.08