SCOP 1.73: Domain d2g6wa1: 2g6w A:2-384

Lineage for d2g6wa1 (2g6w A:2-384)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (8 families)

5. Family c.67.1.4: GABA-aminotransferase-like [53417] (16 proteins)
   formerly omega-Aminoacid:pyruvate aminotransferase-like

6. Protein PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) [53436] (1 species)

7. Species Escherichia coli [TaxId:562] [53437] (4 PDB entries)

8. Domain d2g6wa1: 2g6w A:2-384 [134719]
   automatically matched to d1bs0a_
   complexed with llf

Details for d2g6wa1

PDB Entry: 2g6w, 2.14 Å

PDB Description: suicide inhibition of a-oxamine synthase: structures of the covalent adducts of 8-amino-7-oxonanoate synthase with trifluoroalanine

PDB Compounds: (A:) 8-amino-7-oxononanoate synthase

SCOP Domain Sequences for d2g6wa1:

Sequence; same for both SEQRES and ATOM records:

>d2g6wa1 c.67.1.4 (A:2-384) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]}
swqekinaaldarraadalrrrypvaqgagrwlvaddrqylnfssndylglshhpqiira
wqqgaeqfgigsggsghvsgysvvhqaleeelaewlgysrallfisgfaanqaviaamma
kedriaadrlshaslleaaslspsqlrrfahndvthlarllaspcpgqqmvvtegvfsmd
gdsaplaeiqqvtqqhngwlmvddahgtgvigeqgrgscwlqkvkpellvvtfgkgfgvs
gaavlcsstvadyllqfarhliystsmppaqaqalraslavirsdegdarreklaalitr
fragvqdlpftladscsaiqplivgdnsralqlaeklrqqgcwvtairpptvpagtarlr
ltltaahemqdidrllevlhgng

Timeline for d2g6wa1:

• d2g6wa1 is new in SCOP 1.73
  
• d2g6wa1 appears in SCOP 1.75
  
• d2g6wa1 appears in the current release, SCOPe 2.08, called d2g6wa_