Lineage for d2g6wa_ (2g6w A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896011Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2896366Protein automated matches [190152] (25 species)
    not a true protein
  7. 2896409Species Escherichia coli [TaxId:562] [187107] (2 PDB entries)
  8. 2896410Domain d2g6wa_: 2g6w A: [134719]
    automated match to d1bs0a_
    complexed with llf

Details for d2g6wa_

PDB Entry: 2g6w (more details), 2.14 Å

PDB Description: suicide inhibition of a-oxamine synthase: structures of the covalent adducts of 8-amino-7-oxonanoate synthase with trifluoroalanine
PDB Compounds: (A:) 8-amino-7-oxononanoate synthase

SCOPe Domain Sequences for d2g6wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g6wa_ c.67.1.4 (A:) automated matches {Escherichia coli [TaxId: 562]}
swqekinaaldarraadalrrrypvaqgagrwlvaddrqylnfssndylglshhpqiira
wqqgaeqfgigsggsghvsgysvvhqaleeelaewlgysrallfisgfaanqaviaamma
kedriaadrlshaslleaaslspsqlrrfahndvthlarllaspcpgqqmvvtegvfsmd
gdsaplaeiqqvtqqhngwlmvddahgtgvigeqgrgscwlqkvkpellvvtfgkgfgvs
gaavlcsstvadyllqfarhliystsmppaqaqalraslavirsdegdarreklaalitr
fragvqdlpftladscsaiqplivgdnsralqlaeklrqqgcwvtairpptvpagtarlr
ltltaahemqdidrllevlhgng

SCOPe Domain Coordinates for d2g6wa_:

Click to download the PDB-style file with coordinates for d2g6wa_.
(The format of our PDB-style files is described here.)

Timeline for d2g6wa_: