SCOPe 2.08: Domain d2g6tb_: 2g6t B:

Lineage for d2g6tb_ (2g6t B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.147: CAC2185-like [142794] (1 superfamily)
   consists of two non-similar domains, 3 layers (a/b/a) each; d1 has parallel sheet of 4 strands, order 2134; d2 has parallel sheet of 5 strands, order 21345, and antiparallel meander sheet of 3 strands

4. Superfamily c.147.1: CAC2185-like [142795] (1 family)

5. Family c.147.1.1: CAC2185-like [142796] (1 protein)

6. Protein Hypothetical protein CAC2185 [142797] (1 species)

7. Species Clostridium acetobutylicum [TaxId:1488] [142798] (1 PDB entry)
   Uniprot Q97H28 1-305

8. Domain d2g6tb_: 2g6t B: [134718]
   automated match to d2g6ta1

Details for d2g6tb_

PDB Entry: 2g6t, 3 Å

PDB Description: crystal structure of an uncharacterized protein from clostridium acetobutylicum

PDB Compounds: (B:) Uncharacterized protein, homolog HI1244 from Haemophilus influenzae

SCOPe Domain Sequences for d2g6tb_:

Sequence; same for both SEQRES and ATOM records:

>d2g6tb_ c.147.1.1 (B:) Hypothetical protein CAC2185 {Clostridium acetobutylicum [TaxId: 1488]}
mykcliwgvndeytlaydkllfeiskgnlsiealiskdkyakyidgkevidkteisnyef
dyiiifnkerysdiknealelgiperkilngkfffisnfdfkrycklienpitiisddcw
gglvssylgfkfnspfinfyihnddyikflenmdyyleqelkveqegnvysctmpkgslg
tgdnkiilnfnhqasfaeakndwderktrinkknlfvkmlikddneklvkrfdnlpyknk
vcfhpkpmkyksvaffpryiwrcinyaartsnsnleqytmdmswlekscdilkmlcgeed
firekx

Timeline for d2g6tb_:

• d2g6tb_ first appeared in SCOP 1.73, called d2g6tb1
  
• d2g6tb_ appears in SCOPe 2.07