SCOPe 2.07: Domain d2g6ta1: 2g6t A:1-305

Lineage for d2g6ta1 (2g6t A:1-305)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.147: CAC2185-like [142794] (1 superfamily)
   consists of two non-similar domains, 3 layers (a/b/a) each; d1 has parallel sheet of 4 strands, order 2134; d2 has parallel sheet of 5 strands, order 21345, and antiparallel meander sheet of 3 strands

4. Superfamily c.147.1: CAC2185-like [142795] (1 family)

5. Family c.147.1.1: CAC2185-like [142796] (1 protein)

6. Protein Hypothetical protein CAC2185 [142797] (1 species)

7. Species Clostridium acetobutylicum [TaxId:1488] [142798] (1 PDB entry)
   Uniprot Q97H28 1-305

8. Domain d2g6ta1: 2g6t A:1-305 [134717]

Details for d2g6ta1

PDB Entry: 2g6t, 3 Å

PDB Description: crystal structure of an uncharacterized protein from clostridium acetobutylicum

PDB Compounds: (A:) Uncharacterized protein, homolog HI1244 from Haemophilus influenzae

SCOPe Domain Sequences for d2g6ta1:

Sequence; same for both SEQRES and ATOM records:

>d2g6ta1 c.147.1.1 (A:1-305) Hypothetical protein CAC2185 {Clostridium acetobutylicum [TaxId: 1488]}
mykcliwgvndeytlaydkllfeiskgnlsiealiskdkyakyidgkevidkteisnyef
dyiiifnkerysdiknealelgiperkilngkfffisnfdfkrycklienpitiisddcw
gglvssylgfkfnspfinfyihnddyikflenmdyyleqelkveqegnvysctmpkgslg
tgdnkiilnfnhqasfaeakndwderktrinkknlfvkmlikddneklvkrfdnlpyknk
vcfhpkpmkyksvaffpryiwrcinyaartsnsnleqytmdmswlekscdilkmlcgeed
firek

Timeline for d2g6ta1:

• d2g6ta1 first appeared in SCOP 1.73
  
• d2g6ta1 appears in SCOPe 2.06
  
• d2g6ta1 appears in the current release, SCOPe 2.08