Lineage for d2g6ta1 (2g6t A:1-305)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 713679Fold c.147: CAC2185-like [142794] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each; d1 has parallel sheet of 4 strands, order 2134; d2 has parallel sheet of 5 strands, order 21345, and antiparallel meander sheet of 3 strands
  4. 713680Superfamily c.147.1: CAC2185-like [142795] (1 family) (S)
  5. 713681Family c.147.1.1: CAC2185-like [142796] (1 protein)
  6. 713682Protein Hypothetical protein CAC2185 [142797] (1 species)
  7. 713683Species Clostridium acetobutylicum [TaxId:1488] [142798] (1 PDB entry)
  8. 713684Domain d2g6ta1: 2g6t A:1-305 [134717]

Details for d2g6ta1

PDB Entry: 2g6t (more details), 3 Å

PDB Description: crystal structure of an uncharacterized protein from clostridium acetobutylicum
PDB Compounds: (A:) Uncharacterized protein, homolog HI1244 from Haemophilus influenzae

SCOP Domain Sequences for d2g6ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g6ta1 c.147.1.1 (A:1-305) Hypothetical protein CAC2185 {Clostridium acetobutylicum [TaxId: 1488]}
mykcliwgvndeytlaydkllfeiskgnlsiealiskdkyakyidgkevidkteisnyef
dyiiifnkerysdiknealelgiperkilngkfffisnfdfkrycklienpitiisddcw
gglvssylgfkfnspfinfyihnddyikflenmdyyleqelkveqegnvysctmpkgslg
tgdnkiilnfnhqasfaeakndwderktrinkknlfvkmlikddneklvkrfdnlpyknk
vcfhpkpmkyksvaffpryiwrcinyaartsnsnleqytmdmswlekscdilkmlcgeed
firek

SCOP Domain Coordinates for d2g6ta1:

Click to download the PDB-style file with coordinates for d2g6ta1.
(The format of our PDB-style files is described here.)

Timeline for d2g6ta1: