Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily) unusual fold |
Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) automatically mapped to Pfam PF02898 |
Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins) |
Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species) |
Species Cow (Bos taurus) [TaxId:9913] [56517] (93 PDB entries) Uniprot P29473 67-482 |
Domain d2g6oa_: 2g6o A: [134715] automated match to d1d0ca_ complexed with act, arg, cac, cmo, gol, hem, zn |
PDB Entry: 2g6o (more details), 1.9 Å
SCOPe Domain Sequences for d2g6oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g6oa_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Cow (Bos taurus) [TaxId: 9913]} gpkfprvknwelgsitydtlcaqsqqdgpctprrclgslvlprklqtrpspgpppaeqll sqardfinqyyssikrsgsqaheerlqeveaevastgtyhlreselvfgakqawrnaprc vgriqwgklqvfdardcssaqemftyicnhikyatnrgnlrsaitvfpqrapgrgdfriw nsqlvryagyrqqdgsvrgdpanveitelciqhgwtpgngrfdvlplllqapdeapelfv lppelvlevplehptlewfaalglrwyalpavsnmlleigglefsaapfsgwymsteigt rnlcdphryniledvavcmdldtrttsslwkdkaaveinlavlhsfqlakvtivdhhaat vsfmkhldneqkarggcpadwawivppisgsltpvfhqemvnyilspafryqpdpw
Timeline for d2g6oa_: