Lineage for d2g6lb_ (2g6l B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2609056Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 2609057Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 2609058Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 2609059Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 2609449Species Norway rat (Rattus norvegicus) [TaxId:10116] [82821] (276 PDB entries)
    Uniprot P29476 298-716
  8. 2609553Domain d2g6lb_: 2g6l B: [134710]
    automated match to d1om4b_
    complexed with act, arg, hbi, hem, no, zn

Details for d2g6lb_

PDB Entry: 2g6l (more details), 2.05 Å

PDB Description: Structure of rat nNOS heme domain (BH2 bound) complexed with NO
PDB Compounds: (B:) Nitric-oxide synthase, brain

SCOPe Domain Sequences for d2g6lb_:

Sequence, based on SEQRES records: (download)

>d2g6lb_ d.174.1.1 (B:) Nitric oxide (NO) synthase oxygenase domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rflkvknwetdvvltdtlhlkstletgctehicmgsimlpsqhtrkpedvrtkdqlfpla
kefldqyyssikrfgskahmdrleevnkeieststyqlkdteliygakhawrnasrcvgr
iqwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwnsq
liryagykqpdgstlgdpanvqfteiciqqgwkaprgrfdvlplllqangndpelfqipp
elvlevpirhpkfdwfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrdy
cdnsrynileevakkmdldmrktsslwkdqalveiniavlysfqsdkvtivdhhsatesf
ikhmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvwkg

Sequence, based on observed residues (ATOM records): (download)

>d2g6lb_ d.174.1.1 (B:) Nitric oxide (NO) synthase oxygenase domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rflkvknwetdvvltdtlhlkstletgctehicmgsimlpvrtkdqlfplakefldqyys
sikrfgskahmdrleevnkeieststyqlkdteliygakhawrnasrcvgriqwsklqvf
dardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwnsqliryagykq
pdgstlgdpanvqfteiciqqgwkaprgrfdvlplllqangndpelfqippelvlevpir
hpkfdwfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrdycdnsrynil
eevakkmdldmrktsslwkdqalveiniavlysfqsdkvtivdhhsatesfikhmeneyr
crggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvwkg

SCOPe Domain Coordinates for d2g6lb_:

Click to download the PDB-style file with coordinates for d2g6lb_.
(The format of our PDB-style files is described here.)

Timeline for d2g6lb_: