Lineage for d2g6ka1 (2g6k A:299-716)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 738598Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 738599Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
  5. 738600Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (1 protein)
  6. 738601Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 738757Species Rat (Rattus norvegicus) [TaxId:10116] [82821] (31 PDB entries)
  8. 738777Domain d2g6ka1: 2g6k A:299-716 [134707]
    automatically matched to d1om4b_
    complexed with act, arg, h4b, hem, no, zn

Details for d2g6ka1

PDB Entry: 2g6k (more details), 2 Å

PDB Description: Structure of rat nNOS heme domain (BH4 bound) complexed with NO
PDB Compounds: (A:) Nitric-oxide synthase, brain

SCOP Domain Sequences for d2g6ka1:

Sequence, based on SEQRES records: (download)

>d2g6ka1 d.174.1.1 (A:299-716) Nitric oxide (NO) synthase oxygenase domain {Rat (Rattus norvegicus) [TaxId: 10116]}
rflkvknwetdvvltdtlhlkstletgctehicmgsimlpsqhtrkpedvrtkdqlfpla
kefldqyyssikrfgskahmdrleevnkeieststyqlkdteliygakhawrnasrcvgr
iqwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwnsq
liryagykqpdgstlgdpanvqfteiciqqgwkaprgrfdvlplllqangndpelfqipp
elvlevpirhpkfdwfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrdy
cdnsrynileevakkmdldmrktsslwkdqalveiniavlysfqsdkvtivdhhsatesf
ikhmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw

Sequence, based on observed residues (ATOM records): (download)

>d2g6ka1 d.174.1.1 (A:299-716) Nitric oxide (NO) synthase oxygenase domain {Rat (Rattus norvegicus) [TaxId: 10116]}
rflkvknwetdvvltdtlhlkstletgctehicmgsimlpvrtkdqlfplakefldqyys
sikrfgskahmdrleevnkeieststyqlkdteliygakhawrnasrcvgriqwsklqvf
dardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwnsqliryagykq
pdgstlgdpanvqfteiciqqgwkaprgrfdvlplllqangndpelfqippelvlevpir
hpkfdwfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrdycdnsrynil
eevakkmdldmrktsslwkdqalveiniavlysfqsdkvtivdhhsatesfikhmeneyr
crggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw

SCOP Domain Coordinates for d2g6ka1:

Click to download the PDB-style file with coordinates for d2g6ka1.
(The format of our PDB-style files is described here.)

Timeline for d2g6ka1: