Lineage for d2g6ba1 (2g6b A:58-227)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867419Protein Rab26 [142259] (1 species)
  7. 2867420Species Human (Homo sapiens) [TaxId:9606] [142260] (1 PDB entry)
    Uniprot Q9ULW5 58-227
  8. 2867421Domain d2g6ba1: 2g6b A:58-227 [134701]
    complexed with gnp, mg, unx

Details for d2g6ba1

PDB Entry: 2g6b (more details), 2 Å

PDB Description: crystal structure of human rab26 in complex with a gtp analogue
PDB Compounds: (A:) Ras-related protein Rab-26

SCOPe Domain Sequences for d2g6ba1:

Sequence, based on SEQRES records: (download)

>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]}
dfydvafkvmlvgdsgvgktcllvrfkdgaflagtfistvgidfrnkvldvdgvkvklqm
wdtagqerfrsvthayyrdahallllydvtnkasfdniqawlteiheyaqhdvalmllgn
kvdsahervvkredgeklakeyglpfmetsaktglnvdlaftaiakelkr

Sequence, based on observed residues (ATOM records): (download)

>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]}
dfydvafkvmlvgdsgvgktcllvrfkdgaflagtfistvgidfrnkvldvdgvkvklqm
wdtagqayyrdahallllydvtnkasfdniqawlteiheyaqhdvalmllgnkvdsaher
vvkredgeklakeyglpfmetsaktglnvdlaftaiakelkr

SCOPe Domain Coordinates for d2g6ba1:

Click to download the PDB-style file with coordinates for d2g6ba1.
(The format of our PDB-style files is described here.)

Timeline for d2g6ba1: