Lineage for d2g64a1 (2g64 A:1-139)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 868802Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 868803Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (4 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 868965Family d.96.1.2: 6-pyruvoyl tetrahydropterin synthase [55625] (1 protein)
  6. 868966Protein 6-pyruvoyl tetrahydropterin synthase [55626] (4 species)
    beta-sheets of three subunits form a barrel, closed: n=12, S=12
  7. 868967Species Caenorhabditis elegans [TaxId:6239] [143628] (1 PDB entry)
    Uniprot O02058 1-139
  8. 868968Domain d2g64a1: 2g64 A:1-139 [134694]
    complexed with gol, na, zn; mutant

Details for d2g64a1

PDB Entry: 2g64 (more details), 1.8 Å

PDB Description: structure of caenorhabditis elegans 6-pyruvoyl tetrahydropterin synthase
PDB Compounds: (A:) Putative 6-pyruvoyl tetrahydrobiopterin synthase

SCOP Domain Sequences for d2g64a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g64a1 d.96.1.2 (A:1-139) 6-pyruvoyl tetrahydropterin synthase {Caenorhabditis elegans [TaxId: 6239]}
mfrmpivtmervdsfsaahrlhseklsdaenketfgkcnnsnghghnyvwkvklrgevdp
tsgmvydlaklkkemslvldtvdhrnldkdveffkttvstsenvaiymfeklksvmsnps
vlykvtieetpkniftykg

SCOP Domain Coordinates for d2g64a1:

Click to download the PDB-style file with coordinates for d2g64a1.
(The format of our PDB-style files is described here.)

Timeline for d2g64a1: