Lineage for d2g64a1 (2g64 A:1-139)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2966179Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 2966180Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 2966409Family d.96.1.2: 6-pyruvoyl tetrahydropterin synthase [55625] (2 proteins)
  6. 2966410Protein 6-pyruvoyl tetrahydropterin synthase [55626] (4 species)
    beta-sheets of three subunits form a barrel, closed: n=12, S=12
  7. 2966415Species Nematode (Caenorhabditis elegans) [TaxId:6239] [143628] (1 PDB entry)
    Uniprot O02058 1-139
  8. 2966416Domain d2g64a1: 2g64 A:1-139 [134694]
    complexed with gol, na, zn

Details for d2g64a1

PDB Entry: 2g64 (more details), 1.8 Å

PDB Description: structure of caenorhabditis elegans 6-pyruvoyl tetrahydropterin synthase
PDB Compounds: (A:) Putative 6-pyruvoyl tetrahydrobiopterin synthase

SCOPe Domain Sequences for d2g64a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g64a1 d.96.1.2 (A:1-139) 6-pyruvoyl tetrahydropterin synthase {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
mfrmpivtmervdsfsaahrlhseklsdaenketfgkcnnsnghghnyvwkvklrgevdp
tsgmvydlaklkkemslvldtvdhrnldkdveffkttvstsenvaiymfeklksvmsnps
vlykvtieetpkniftykg

SCOPe Domain Coordinates for d2g64a1:

Click to download the PDB-style file with coordinates for d2g64a1.
(The format of our PDB-style files is described here.)

Timeline for d2g64a1: