Lineage for d2g63d2 (2g63 D:509-764)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2902215Species Human (Homo sapiens) [TaxId:9606] [188340] (99 PDB entries)
  8. 2902281Domain d2g63d2: 2g63 D:509-764 [134693]
    Other proteins in same PDB: d2g63a1, d2g63b1, d2g63c1, d2g63d1
    automated match to d2g63d2
    complexed with aaf

Details for d2g63d2

PDB Entry: 2g63 (more details), 2 Å

PDB Description: crystal structure of human dipeptidyl peptidase iv (dppiv) complexed with cyanopyrrolidine (c5-pro-pro) inhibitor 24b
PDB Compounds: (D:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d2g63d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g63d2 c.69.1.0 (D:509-764) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfs

SCOPe Domain Coordinates for d2g63d2:

Click to download the PDB-style file with coordinates for d2g63d2.
(The format of our PDB-style files is described here.)

Timeline for d2g63d2: