![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) ![]() |
![]() | Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins) |
![]() | Protein 12-oxophytodienoate reductase (OPR, OYE homolog) [63896] (3 species) |
![]() | Species Thale cress (Arabidopsis thaliana), OPR3 [TaxId:3702] [102041] (2 PDB entries) |
![]() | Domain d2g5wb_: 2g5w B: [134683] automated match to d1q45a_ complexed with 8pg, fmn has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2g5w (more details), 2.58 Å
SCOPe Domain Sequences for d2g5wb_:
Sequence, based on SEQRES records: (download)
>d2g5wb_ c.1.4.1 (B:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Thale cress (Arabidopsis thaliana), OPR3 [TaxId: 3702]} netlfssykmgrfdlshrvvlapmtrcralngvpnaalaeyyaqrttpggflisegtmvs pgsagfphvpgiysdeqveawkqvveavhakggfifcqlwhvgrashavyqpnggspiss tnkpisenrwrvllpdgshvkypkpraleaseiprvvedyclsalnairagfdgieihga hgylidqflkdgindrtdqyggsianrcrflkqvvegvvsaigaskvgvrvspaidhlda tdsdplslglavvgmlnklqgvngsklaylhvtqpryhaygqtesgrqgsdeeeaklmks lrmayngtfmssggfnkelgmqavqqgdadlvsygrlfianpdlvsrfkidgelnkynrk tfytqdpvvgytdypfl
>d2g5wb_ c.1.4.1 (B:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Thale cress (Arabidopsis thaliana), OPR3 [TaxId: 3702]} netlfssykmgrfdlshrvvlapmtrcralngvpnaalaeyyaqrttpggflisegtmvs pgsagfphvpgiysdeqveawkqvveavhakggfifcqlwhvgrashavyqpnggspiss tnkpisenrwrvllpdgshvkypkpraleaseiprvvedyclsalnairagfdgieihga hgylidqflkdgindrtdqyggsianrcrflkqvvegvvsaigaskvgvrvspaidhlda tdsdplslglavvgmlnklqgvngsklaylhvtqpryhayeeeaklmkslrmayngtfms sggfnkelgmqavqqgdadlvsygrlfianpdlvsrfkidgelnkynrktfytqdpvvgy tdypfl
Timeline for d2g5wb_: