Lineage for d2g5wa_ (2g5w A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080001Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2080008Protein 12-oxophytodienoate reductase (OPR, OYE homolog) [63896] (3 species)
  7. 2080011Species Thale cress (Arabidopsis thaliana), OPR3 [TaxId:3702] [102041] (2 PDB entries)
  8. 2080014Domain d2g5wa_: 2g5w A: [134682]
    automated match to d1q45a_
    complexed with 8pg, fmn

Details for d2g5wa_

PDB Entry: 2g5w (more details), 2.58 Å

PDB Description: x-ray crystal structure of arabidopsis thaliana 12-oxophytodienoate reductase isoform 3 (atopr3) in complex with 8-iso prostaglandin a1 and its cofactor, flavin mononucleotide.
PDB Compounds: (A:) 12-oxophytodienoate reductase 3

SCOPe Domain Sequences for d2g5wa_:

Sequence, based on SEQRES records: (download)

>d2g5wa_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Thale cress (Arabidopsis thaliana), OPR3 [TaxId: 3702]}
snetlfssykmgrfdlshrvvlapmtrcralngvpnaalaeyyaqrttpggflisegtmv
spgsagfphvpgiysdeqveawkqvveavhakggfifcqlwhvgrashavyqpnggspis
stnkpisenrwrvllpdgshvkypkpraleaseiprvvedyclsalnairagfdgieihg
ahgylidqflkdgindrtdqyggsianrcrflkqvvegvvsaigaskvgvrvspaidhld
atdsdplslglavvgmlnklqgvngsklaylhvtqpryhaygqtesgrqgsdeeeaklmk
slrmayngtfmssggfnkelgmqavqqgdadlvsygrlfianpdlvsrfkidgelnkynr
ktfytqdpvvgytdypflap

Sequence, based on observed residues (ATOM records): (download)

>d2g5wa_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Thale cress (Arabidopsis thaliana), OPR3 [TaxId: 3702]}
snetlfssykmgrfdlshrvvlapmtrcralngvpnaalaeyyaqrttpggflisegtmv
spgsagfphvpgiysdeqveawkqvveavhakggfifcqlwhvgrashavyqpnggspis
stnkpisenrwrvllpdgshvkypkpraleaseiprvvedyclsalnairagfdgieihg
ahgylidqflkdgindrtdqyggsianrcrflkqvvegvvsaigaskvgvrvspaidhld
atdsdplslglavvgmlnklqgvngsklaylhvtqpreaklmkslrmayngtfmssggfn
kelgmqavqqgdadlvsygrlfianpdlvsrfkidgelnkynrktfytqdpvvgytdypf
lap

SCOPe Domain Coordinates for d2g5wa_:

Click to download the PDB-style file with coordinates for d2g5wa_.
(The format of our PDB-style files is described here.)

Timeline for d2g5wa_: