Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (131 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188340] (99 PDB entries) |
Domain d2g5tb2: 2g5t B:509-764 [134678] Other proteins in same PDB: d2g5ta1, d2g5tb1 automated match to d2g63a2 complexed with acf |
PDB Entry: 2g5t (more details), 2.3 Å
SCOPe Domain Sequences for d2g5tb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g5tb2 c.69.1.0 (B:509-764) automated matches {Human (Homo sapiens) [TaxId: 9606]} mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah qhiythmshfikqcfs
Timeline for d2g5tb2: