Lineage for d2g5tb1 (2g5t B:39-508)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 675578Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 675662Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) (S)
  5. 675663Family b.70.3.1: DPP6 N-terminal domain-like [82172] (2 proteins)
    Pfam PF00930
  6. 675670Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)
  7. 675698Species Pig (Sus scrofa) [TaxId:9823] [89381] (28 PDB entries)
  8. 675726Domain d2g5tb1: 2g5t B:39-508 [134677]
    Other proteins in same PDB: d2g5ta2, d2g5tb2
    automatically matched to d1orva1
    complexed with acf

Details for d2g5tb1

PDB Entry: 2g5t (more details), 2.3 Å

PDB Description: crystal structure of human dipeptidyl peptidase iv (dppiv) complexed with cyanopyrrolidine (c5-pro-pro) inhibitor 21ag
PDB Compounds: (B:) dipeptidyl peptidase 4

SCOP Domain Sequences for d2g5tb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g5tb1 b.70.3.1 (B:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

SCOP Domain Coordinates for d2g5tb1:

Click to download the PDB-style file with coordinates for d2g5tb1.
(The format of our PDB-style files is described here.)

Timeline for d2g5tb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2g5tb2