Lineage for d2g5ra1 (2g5r A:24-144)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 653948Protein N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) [89176] (1 species)
  7. 653949Species Human (Homo sapiens) [TaxId:9606] [89177] (6 PDB entries)
  8. 653950Domain d2g5ra1: 2g5r A:24-144 [134674]
    automatically matched to d1o7va_
    complexed with cys, nag, nxd

Details for d2g5ra1

PDB Entry: 2g5r (more details), 1.6 Å

PDB Description: crystal structure of siglec-7 in complex with methyl-9-(aminooxalyl- amino)-9-deoxyneu5ac (oxamido-neu5ac)
PDB Compounds: (A:) Sialic acid-binding Ig-like lectin 7

SCOP Domain Sequences for d2g5ra1:

Sequence, based on SEQRES records: (download)

>d2g5ra1 b.1.1.1 (A:24-144) N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) {Human (Homo sapiens) [TaxId: 9606]}
kdysltmqssvtvqegmcvhvrcsfsypvdsqtdsdpvhgywfragndiswkapvatnnp
awavqeetrdrfhllgdpqtknctlsirdarmsdagryffrmekgnikwnykydqlsvnv
t

Sequence, based on observed residues (ATOM records): (download)

>d2g5ra1 b.1.1.1 (A:24-144) N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) {Human (Homo sapiens) [TaxId: 9606]}
kdysltmqssvtvqegmcvhvrcsfsypsqtdsdpvhgywfragkapvatnnpawavqee
trdrfhllgdpqtknctlsirdarmsdagryffrmekgnikwnykydqlsvnvt

SCOP Domain Coordinates for d2g5ra1:

Click to download the PDB-style file with coordinates for d2g5ra1.
(The format of our PDB-style files is described here.)

Timeline for d2g5ra1: