SCOP 1.75: Domain d2g5pb2: 2g5p B:509-764

Lineage for d2g5pb2 (2g5p B:509-764)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (41 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins)
   N-terminal domain is a 8-bladed beta-propeller

6. Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [89771] (28 PDB entries)

8. Domain d2g5pb2: 2g5p B:509-764 [134673]
   Other proteins in same PDB: d2g5pa1, d2g5pb1
   automatically matched to d1orva2
   complexed with adf

Details for d2g5pb2

PDB Entry: 2g5p, 2.4 Å

PDB Description: crystal structure of human dipeptidyl peptidase iv (dppiv) complexed with cyanopyrrolidine (c5-pro-pro) inhibitor 21ac

PDB Compounds: (B:) dipeptidyl peptidase 4

SCOP Domain Sequences for d2g5pb2:

Sequence; same for both SEQRES and ATOM records:

>d2g5pb2 c.69.1.24 (B:509-764) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfs

Timeline for d2g5pb2:

• d2g5pb2 first appeared in SCOP 1.73
  
• d2g5pb2 appears in SCOPe 2.01
  
• d2g5pb2 appears in the current release, SCOPe 2.08