Lineage for d2g5pa2 (2g5p A:509-764)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 706658Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 706659Superfamily c.69.1: alpha/beta-Hydrolases [53474] (35 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 707432Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins)
    N-terminal domain is a 8-bladed beta-propeller
  6. 707439Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species)
  7. 707467Species Pig (Sus scrofa) [TaxId:9823] [89771] (28 PDB entries)
  8. 707508Domain d2g5pa2: 2g5p A:509-764 [134671]
    Other proteins in same PDB: d2g5pa1, d2g5pb1
    automatically matched to d1orva2
    complexed with adf

Details for d2g5pa2

PDB Entry: 2g5p (more details), 2.4 Å

PDB Description: crystal structure of human dipeptidyl peptidase iv (dppiv) complexed with cyanopyrrolidine (c5-pro-pro) inhibitor 21ac
PDB Compounds: (A:) dipeptidyl peptidase 4

SCOP Domain Sequences for d2g5pa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g5pa2 c.69.1.24 (A:509-764) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfs

SCOP Domain Coordinates for d2g5pa2:

Click to download the PDB-style file with coordinates for d2g5pa2.
(The format of our PDB-style files is described here.)

Timeline for d2g5pa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2g5pa1