Lineage for d2g5na1 (2g5n A:7-229)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 802045Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 802046Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 802237Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)
  6. 803036Protein Trypsin(ogen) [50515] (9 species)
  7. 803037Species Cow (Bos taurus) [TaxId:9913] [50516] (279 PDB entries)
    Uniprot P00760
  8. 803104Domain d2g5na1: 2g5n A:7-229 [134669]
    automatically matched to d1tgsz_
    complexed with 23m, ca, so4

Details for d2g5na1

PDB Entry: 2g5n (more details), 1.51 Å

PDB Description: Indole-amidine Complexes with Bovine Trypsin
PDB Compounds: (A:) cationic trypsin

SCOP Domain Sequences for d2g5na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g5na1 b.47.1.2 (A:7-229) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOP Domain Coordinates for d2g5na1:

Click to download the PDB-style file with coordinates for d2g5na1.
(The format of our PDB-style files is described here.)

Timeline for d2g5na1: