SCOPe 2.08: Domain d2g5ib2: 2g5i B:2-293

Lineage for d2g5ib2 (2g5i B:2-293)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
   duplication: common core consists of two beta-alpha-beta2-alpha repeats

4. Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families)

5. Family d.128.1.5: GatB/GatE catalytic domain-like [143812] (2 proteins)
   N-terminal and C-terminal parts correspond to Pfam PF02934 (GatB_N) and Pfam PF01162 (GatB), respectively

6. Protein Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B, GatB, N-terminal domain [143813] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [143814] (5 PDB entries)
   Uniprot P64201 2-293

8. Domain d2g5ib2: 2g5i B:2-293 [134664]
   Other proteins in same PDB: d2g5ia1, d2g5ib1, d2g5ic1
   automatically matched to 2DF4 B:2-293
   protein/RNA complex; complexed with adp, mg

Details for d2g5ib2

PDB Entry: 2g5i, 3.35 Å

PDB Description: Structure of tRNA-Dependent Amidotransferase GatCAB complexed with ADP-AlF4

PDB Compounds: (B:) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B

SCOPe Domain Sequences for d2g5ib2:

Sequence; same for both SEQRES and ATOM records:

>d2g5ib2 d.128.1.5 (B:2-293) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B, GatB, N-terminal domain {Staphylococcus aureus [TaxId: 1280]}
hfetviglevhvelktdskmfspspahfgaepnsntnvidlaypgvlpvvnkravdwamr
aamalnmeiateskfdrknyfypdnpkayqisqfdqpigengyidievdgetkrigitrl
hmeedagksthkgeyslvdlnrqgtplieivsepdirspkeayayleklrsiiqytgvsd
vkmeegslrcdanislrpygqekfgtkaelknlnsfnyvrkgleyeekrqeeellnggei
gqetrrfdestgktilmrvkegsddyryfpepdivplyiddawkervrqtip

Timeline for d2g5ib2:

• d2g5ib2 first appeared in SCOP 1.73
  
• d2g5ib2 appears in SCOPe 2.07