SCOP 1.73: Domain d2g5ib1: 2g5i B:294-400

Lineage for d2g5ib1 (2g5i B:294-400)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.182: GatB/YqeY motif [89094] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles (4-helical and 3-helical)

4. Superfamily a.182.1: GatB/YqeY motif [89095] (2 families)

5. Family a.182.1.2: GatB/GatE C-terminal domain-like [140757] (2 proteins)
   assigned to the same Pfam PF02637 family as YeqY by the presence of a common sequence motif with an alpha-hairpin structure

6. Protein Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B, GatB, C-terminal domain [140758] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [140759] (5 PDB entries)

8. Domain d2g5ib1: 2g5i B:294-400 [134663]
   Other proteins in same PDB: d2g5ia1, d2g5ib2, d2g5ic1
   automatically matched to 2DF4 B:294-400
   complexed with adp, mg

Details for d2g5ib1

PDB Entry: 2g5i, 3.35 Å

PDB Description: Structure of tRNA-Dependent Amidotransferase GatCAB complexed with ADP-AlF4

PDB Compounds: (B:) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B

SCOP Domain Sequences for d2g5ib1:

Sequence; same for both SEQRES and ATOM records:

>d2g5ib1 a.182.1.2 (B:294-400) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B, GatB, C-terminal domain {Staphylococcus aureus [TaxId: 1280]}
elpderkakyvnelglpaydahvltltkemsdffestiehgadvkltsnwlmggvneyln
knqvelldtkltpenlagmikliedgtmsskiakkvfpelaakggna

Timeline for d2g5ib1:

• d2g5ib1 is new in SCOP 1.73
  
• d2g5ib1 appears in SCOP 1.75
  
• d2g5ib1 appears in the current release, SCOPe 2.08