Lineage for d2g5hc_ (2g5h C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2346684Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2347166Superfamily a.137.12: Glu-tRNAGln amidotransferase C subunit [141000] (1 family) (S)
  5. 2347167Family a.137.12.1: Glu-tRNAGln amidotransferase C subunit [141001] (1 protein)
    Pfam PF02686
  6. 2347168Protein Glu-tRNAGln amidotransferase C subunit, GatC [141002] (2 species)
  7. 2347169Species Staphylococcus aureus [TaxId:1280] [141003] (5 PDB entries)
    Uniprot P68807 2-100
  8. 2347171Domain d2g5hc_: 2g5h C: [134661]
    Other proteins in same PDB: d2g5ha_, d2g5hb1, d2g5hb2
    automated match to d2df4c1
    protein/RNA complex; complexed with mg

Details for d2g5hc_

PDB Entry: 2g5h (more details), 2.5 Å

PDB Description: Structure of tRNA-Dependent Amidotransferase GatCAB
PDB Compounds: (C:) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

SCOPe Domain Sequences for d2g5hc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g5hc_ a.137.12.1 (C:) Glu-tRNAGln amidotransferase C subunit, GatC {Staphylococcus aureus [TaxId: 1280]}
tkvtreevehianlarlqispeeteemantlesildfakqndsadtegveptyhvldlqn
vlredkaikgipqelalknaketedgqfkvptimneeda

SCOPe Domain Coordinates for d2g5hc_:

Click to download the PDB-style file with coordinates for d2g5hc_.
(The format of our PDB-style files is described here.)

Timeline for d2g5hc_: