Lineage for d2g5ha_ (2g5h A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150370Fold c.117: Amidase signature (AS) enzymes [75303] (1 superfamily)
    possible duplication: the topologies of N- and C-terminal halves are similar; 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213549A867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2150371Superfamily c.117.1: Amidase signature (AS) enzymes [75304] (1 family) (S)
    automatically mapped to Pfam PF01425
  5. 2150372Family c.117.1.1: Amidase signature (AS) enzymes [75305] (5 protein domains)
  6. 2150391Protein Glutamyl-tRNA(Gln) amidotransferase subunit A [142738] (3 species)
  7. 2150392Species Staphylococcus aureus [TaxId:1280] [142739] (5 PDB entries)
    Uniprot P63488 1-485
  8. 2150394Domain d2g5ha_: 2g5h A: [134658]
    Other proteins in same PDB: d2g5hb1, d2g5hb2, d2g5hc_
    automated match to d2df4a1
    protein/RNA complex; complexed with mg

Details for d2g5ha_

PDB Entry: 2g5h (more details), 2.5 Å

PDB Description: Structure of tRNA-Dependent Amidotransferase GatCAB
PDB Compounds: (A:) Glutamyl-tRNA(Gln) amidotransferase subunit A

SCOPe Domain Sequences for d2g5ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g5ha_ c.117.1.1 (A:) Glutamyl-tRNA(Gln) amidotransferase subunit A {Staphylococcus aureus [TaxId: 1280]}
msiryesvenlltlikdkkikpsdvvkdiydaieetdptiksflaldkenaikkaqelde
lqakdqmdgklfgipmgikdniitnglettcaskmlegfvpiyestvmeklhkenavlig
klnmdefamggstetsyfkktvnpfdhkavpggssggsaaavaaglvplslgsdtggsir
qpaaycgvvgmkptygrvsrfglvafassldqigpltrnvkdnaivleaisgadvndsts
apvddvdftseigkdikglkvalpkeylgegvaddvkeavqnavetlkslgavveevslp
ntkfgipsyyviasseassnlsrfdgirygyhskeahsleelykmsrsegfgkevkrrif
lgtfalssgyydayykksqkvrtlikndfdkvfenydvvvgptapttafnlgeeiddplt
myandllttpvnlaglpgisvpcgqsngrpiglqfigkpfdektlyrvayqyetqynlhd
vyekl

SCOPe Domain Coordinates for d2g5ha_:

Click to download the PDB-style file with coordinates for d2g5ha_.
(The format of our PDB-style files is described here.)

Timeline for d2g5ha_: