SCOPe 2.08: Domain d2g5fd_: 2g5f D:

Lineage for d2g5fd_ (2g5f D:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.161: ADC synthase [56321] (1 superfamily)
   duplication: contains four repeats of alpha-beta(2)-beta motif arranged in a 4 layer core structure: alpha/beta/beta/alpha; orthogonally packed beta-sheets

4. Superfamily d.161.1: ADC synthase [56322] (2 families)
   the active site is formed by additional structures inserted into the core structure

5. Family d.161.1.1: ADC synthase [56323] (6 proteins)

6. Protein Salicylate synthase MbtI [143945] (1 species)
   Mycobactin synthetase protein I

7. Species Mycobacterium tuberculosis [TaxId:1773] [143946] (9 PDB entries)
   Uniprot Q7D785 15-449

8. Domain d2g5fd_: 2g5f D: [134657]
   automated match to d2g5fa1
   complexed with gol, imd, pyr

Details for d2g5fd_

PDB Entry: 2g5f, 1.8 Å

PDB Description: The structure of MbtI from Mycobacterium Tuberculosis, the first enzyme in the synthesis of Mycobactin, reveals it to be a salicylate synthase

PDB Compounds: (D:) COG0147: Anthranilate/para-aminobenzoate synthases component I

SCOPe Domain Sequences for d2g5fd_:

Sequence; same for both SEQRES and ATOM records:

>d2g5fd_ d.161.1.1 (D:) Salicylate synthase MbtI {Mycobacterium tuberculosis [TaxId: 1773]}
sssipmpagvnpadlaaelaavvtesvdedyllyecdgqwvlaagvqamveldsdelrvi
rdgvtrrqqwsgrpgaalgeavdrllletdqafgwvafefgvhryglqqrlaphtplarv
fsprtrimvsekeirlfdagirhreaidrllatgvrevpqsrsvdvsddpsgfrrrvava
vdeiaagryhkvilsrcvevpfaidfpltyrlgrrhntpvrsfllqlggiralgyspelv
tavradgvviteplagtralgrgpaidrlarddlesnskeivehaisvrssleeitdiae
pgsaavidfmtvrergsvqhlgstirarldpssdrmaalealfpavtasgipkaagveai
frldecprglysgavvmlsadggldaaltlraayqvggrtwlragagiieeseperefee
tceklstltpylvar

Timeline for d2g5fd_:

• d2g5fd_ first appeared in SCOP 1.73, called d2g5fd1
  
• d2g5fd_ appears in SCOPe 2.07