Lineage for d2g5fc1 (2g5f C:15-449)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 736993Fold d.161: ADC synthase [56321] (1 superfamily)
    duplication: contains four repeats of alpha-beta(2)-beta motif arranged in a 4 layer core structure: alpha/beta/beta/alpha; orthogonally packed beta-sheets
  4. 736994Superfamily d.161.1: ADC synthase [56322] (1 family) (S)
    the active site is formed by additional structures inserted into the core structure
  5. 736995Family d.161.1.1: ADC synthase [56323] (5 proteins)
  6. 737016Protein Salicylate synthase MbtI [143945] (1 species)
    Mycobactin synthetase protein I
  7. 737017Species Mycobacterium tuberculosis [TaxId:1773] [143946] (2 PDB entries)
  8. 737020Domain d2g5fc1: 2g5f C:15-449 [134656]
    automatically matched to 2G5F A:15-449
    complexed with gol, imd, pyr

Details for d2g5fc1

PDB Entry: 2g5f (more details), 1.8 Å

PDB Description: The structure of MbtI from Mycobacterium Tuberculosis, the first enzyme in the synthesis of Mycobactin, reveals it to be a salicylate synthase
PDB Compounds: (C:) COG0147: Anthranilate/para-aminobenzoate synthases component I

SCOP Domain Sequences for d2g5fc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g5fc1 d.161.1.1 (C:15-449) Salicylate synthase MbtI {Mycobacterium tuberculosis [TaxId: 1773]}
sssipmpagvnpadlaaelaavvtesvdedyllyecdgqwvlaagvqamveldsdelrvi
rdgvtrrqqwsgrpgaalgeavdrllletdqafgwvafefgvhryglqqrlaphtplarv
fsprtrimvsekeirlfdagirhreaidrllatgvrevpqsrsvdvsddpsgfrrrvava
vdeiaagryhkvilsrcvevpfaidfpltyrlgrrhntpvrsfllqlggiralgyspelv
tavradgvviteplagtralgrgpaidrlarddlesnskeivehaisvrssleeitdiae
pgsaavidfmtvrergsvqhlgstirarldpssdrmaalealfpavtasgipkaagveai
frldecprglysgavvmlsadggldaaltlraayqvggrtwlragagiieeseperefee
tceklstltpylvar

SCOP Domain Coordinates for d2g5fc1:

Click to download the PDB-style file with coordinates for d2g5fc1.
(The format of our PDB-style files is described here.)

Timeline for d2g5fc1: