SCOP 1.73: Domain d2g5fa1: 2g5f A:15-449

Lineage for d2g5fa1 (2g5f A:15-449)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.161: ADC synthase [56321] (1 superfamily)
   duplication: contains four repeats of alpha-beta(2)-beta motif arranged in a 4 layer core structure: alpha/beta/beta/alpha; orthogonally packed beta-sheets

4. Superfamily d.161.1: ADC synthase [56322] (1 family)
   the active site is formed by additional structures inserted into the core structure

5. Family d.161.1.1: ADC synthase [56323] (5 proteins)

6. Protein Salicylate synthase MbtI [143945] (1 species)
   Mycobactin synthetase protein I

7. Species Mycobacterium tuberculosis [TaxId:1773] [143946] (2 PDB entries)

8. Domain d2g5fa1: 2g5f A:15-449 [134654]
   complexed with gol, imd, pyr

Details for d2g5fa1

PDB Entry: 2g5f, 1.8 Å

PDB Description: The structure of MbtI from Mycobacterium Tuberculosis, the first enzyme in the synthesis of Mycobactin, reveals it to be a salicylate synthase

PDB Compounds: (A:) COG0147: Anthranilate/para-aminobenzoate synthases component I

SCOP Domain Sequences for d2g5fa1:

Sequence; same for both SEQRES and ATOM records:

>d2g5fa1 d.161.1.1 (A:15-449) Salicylate synthase MbtI {Mycobacterium tuberculosis [TaxId: 1773]}
sssipmpagvnpadlaaelaavvtesvdedyllyecdgqwvlaagvqamveldsdelrvi
rdgvtrrqqwsgrpgaalgeavdrllletdqafgwvafefgvhryglqqrlaphtplarv
fsprtrimvsekeirlfdagirhreaidrllatgvrevpqsrsvdvsddpsgfrrrvava
vdeiaagryhkvilsrcvevpfaidfpltyrlgrrhntpvrsfllqlggiralgyspelv
tavradgvviteplagtralgrgpaidrlarddlesnskeivehaisvrssleeitdiae
pgsaavidfmtvrergsvqhlgstirarldpssdrmaalealfpavtasgipkaagveai
frldecprglysgavvmlsadggldaaltlraayqvggrtwlragagiieeseperefee
tceklstltpylvar

Timeline for d2g5fa1:

• d2g5fa1 is new in SCOP 1.73
  
• d2g5fa1 appears in SCOP 1.75
  
• d2g5fa1 appears in the current release, SCOPe 2.08