![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.161: ADC synthase [56321] (1 superfamily) duplication: contains four repeats of alpha-beta(2)-beta motif arranged in a 4 layer core structure: alpha/beta/beta/alpha; orthogonally packed beta-sheets |
![]() | Superfamily d.161.1: ADC synthase [56322] (2 families) ![]() the active site is formed by additional structures inserted into the core structure |
![]() | Family d.161.1.1: ADC synthase [56323] (6 proteins) |
![]() | Protein Salicylate synthase MbtI [143945] (1 species) Mycobactin synthetase protein I |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [143946] (9 PDB entries) Uniprot Q7D785 15-449 |
![]() | Domain d2g5fa1: 2g5f A:15-449 [134654] complexed with gol, imd, pyr |
PDB Entry: 2g5f (more details), 1.8 Å
SCOPe Domain Sequences for d2g5fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g5fa1 d.161.1.1 (A:15-449) Salicylate synthase MbtI {Mycobacterium tuberculosis [TaxId: 1773]} sssipmpagvnpadlaaelaavvtesvdedyllyecdgqwvlaagvqamveldsdelrvi rdgvtrrqqwsgrpgaalgeavdrllletdqafgwvafefgvhryglqqrlaphtplarv fsprtrimvsekeirlfdagirhreaidrllatgvrevpqsrsvdvsddpsgfrrrvava vdeiaagryhkvilsrcvevpfaidfpltyrlgrrhntpvrsfllqlggiralgyspelv tavradgvviteplagtralgrgpaidrlarddlesnskeivehaisvrssleeitdiae pgsaavidfmtvrergsvqhlgstirarldpssdrmaalealfpavtasgipkaagveai frldecprglysgavvmlsadggldaaltlraayqvggrtwlragagiieeseperefee tceklstltpylvar
Timeline for d2g5fa1: