Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins) the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest C-terminal domains also show some similarity |
Protein Prephenate dehydrogenase TyrA [141929] (3 species) |
Species Aquifex aeolicus [TaxId:63363] [141930] (1 PDB entry) Uniprot O67636 30-200 |
Domain d2g5cd2: 2g5c D:30-200 [134653] Other proteins in same PDB: d2g5ca1, d2g5cb1, d2g5cc1, d2g5cd1 automated match to d2g5ca2 complexed with nad |
PDB Entry: 2g5c (more details), 1.9 Å
SCOPe Domain Sequences for d2g5cd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g5cd2 c.2.1.6 (D:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} mqnvlivgvgfmggsfakslrrsgfkgkiygydinpesiskavdlgiidegttsiakved fspdfvmlsspvrtfreiakklsyilsedatvtdqgsvkgklvydlenilgkrfvgghpi agteksgveysldnlyegkkviltptkktdkkrlklvkrvwedvggvveym
Timeline for d2g5cd2: