SCOPe 2.08: Domain d2g5cd2: 2g5c D:30-200

Lineage for d2g5cd2 (2g5c D:30-200)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins)
   the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
   C-terminal domains also show some similarity

6. Protein Prephenate dehydrogenase TyrA [141929] (3 species)

7. Species Aquifex aeolicus [TaxId:63363] [141930] (1 PDB entry)
   Uniprot O67636 30-200

8. Domain d2g5cd2: 2g5c D:30-200 [134653]
   Other proteins in same PDB: d2g5ca1, d2g5cb1, d2g5cc1, d2g5cd1
   automated match to d2g5ca2
   complexed with nad

Details for d2g5cd2

PDB Entry: 2g5c, 1.9 Å

PDB Description: Crystal Structure of Prephenate Dehydrogenase from Aquifex aeolicus

PDB Compounds: (D:) prephenate dehydrogenase

SCOPe Domain Sequences for d2g5cd2:

Sequence; same for both SEQRES and ATOM records:

>d2g5cd2 c.2.1.6 (D:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]}
mqnvlivgvgfmggsfakslrrsgfkgkiygydinpesiskavdlgiidegttsiakved
fspdfvmlsspvrtfreiakklsyilsedatvtdqgsvkgklvydlenilgkrfvgghpi
agteksgveysldnlyegkkviltptkktdkkrlklvkrvwedvggvveym

Timeline for d2g5cd2:

• d2g5cd2 first appeared in SCOP 1.73
  
• d2g5cd2 appears in SCOPe 2.07