SCOPe 2.08: Domain d2g5cd1: 2g5c D:201-307

Lineage for d2g5cd1 (2g5c D:201-307)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.12: TyrA dimerization domain-like [140780] (1 protein)
   new dimerisation mode with swapping of C-terminal helices

6. Protein Prephenate dehydrogenase TyrA [140781] (3 species)

7. Species Aquifex aeolicus [TaxId:63363] [140782] (1 PDB entry)
   Uniprot O67636 201-310

8. Domain d2g5cd1: 2g5c D:201-307 [134652]
   Other proteins in same PDB: d2g5ca2, d2g5cb2, d2g5cc2, d2g5cd2
   automated match to d2g5ca1
   complexed with nad

Details for d2g5cd1

PDB Entry: 2g5c, 1.9 Å

PDB Description: Crystal Structure of Prephenate Dehydrogenase from Aquifex aeolicus

PDB Compounds: (D:) prephenate dehydrogenase

SCOPe Domain Sequences for d2g5cd1:

Sequence; same for both SEQRES and ATOM records:

>d2g5cd1 a.100.1.12 (D:201-307) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]}
spelhdyvfgvvshlphavafalvdtlihmstpevdlfkypgggfkdftriaksdpimwr
diflenkenvmkaiegfekslnhlkelivreaeeelveylkevkikr

Timeline for d2g5cd1:

• d2g5cd1 first appeared in SCOP 1.73
  
• d2g5cd1 appears in SCOPe 2.07